Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEZ1
Confidence21.39%DateThu Jan 5 11:24:40 GMT 2012
Rank199Aligned Residues62
% Identity18%Templatec3j08A_
PDB info PDB header:hydrolase, metal transportChain: A: PDB Molecule:copper-exporting p-type atpase a; PDBTitle: high resolution helical reconstruction of the bacterial p-type atpase2 copper transporter copa
Resolution10.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60.........70.........80.........90.........100.........110........
Predicted Secondary structure 



























Query SS confidence 















































































Query Sequence  QTLWNSIDRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALR
Query Conservation    
      
    
  



       
  
   
  
    
   
 


 

 
   
   
      

 


 
 
Alig confidence 





















.....................






























.




Template Conservation               
   
 

 .....................    

 
   
  
  
   
  
   

 .
 


Template Sequence  NEVELALEKLEREAKTAVIVAR. . . . . . . . . . . . . . . . . . . . . NGRVEGIIAVSDTLKESAKPAVQELKRMGIK. VGMIT
Template Known Secondary structure  TTT


.....................TT


TTTTT
.
Template Predicted Secondary structure 



.....................










.
Template SS confidence 















































































   515....520.........530...... ...540.........550.........560....... ..570..
 
   119120..
Predicted Secondary structure 



Query SS confidence 



Query Sequence  GDLP
Query Conservation 

 
Alig confidence 



Template Conservation 

  
Template Sequence  GDNW
Template Known Secondary structure  SS
Template Predicted Secondary structure 


Template SS confidence 



   573...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions