Return to main results Retrieve Phyre Job Id

Job DescriptionP32139
Confidence4.37%DateThu Jan 5 11:49:25 GMT 2012
Rank93Aligned Residues25
% Identity20%Templated1yq2a5
SCOP infoTIM beta/alpha-barrel (Trans)glycosidases beta-glycanases
Resolution1.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   73......80.........90.........100........
Predicted Secondary structure 
























Query SS confidence 



































Query Sequence  RIANGCYRYQGQEYQLPINEHSSKAAIHGLLAWRDW
Query Conservation 

        
  
 
  
        

 

   
Alig confidence 















...........








Template Conservation   
    
 




  
........... 
   
   
Template Sequence  RIVGDQFLVNGRRVVF. . . . . . . . . . . HGVNRHETH
Template Known Secondary structure  TTTT

...........



Template Predicted Secondary structure 



...........




Template SS confidence 



































   314.....320......... 330........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions