Return to main results Retrieve Phyre Job Id

Job DescriptionP37645
Confidence3.14%DateThu Jan 5 11:56:17 GMT 2012
Rank11Aligned Residues52
% Identity15%Templatec2qtsA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:acid-sensing ion channel; PDBTitle: structure of an acid-sensing ion channel 1 at 1.9 a resolution and low2 ph
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70.........80
Predicted Secondary structure 






















Query SS confidence 















































































Query Sequence  MSKAGKITAAISGAFLLLIVVAIILIATFDWNRLKPTINQKVSAELNRPFAIRGDLGVVWERQKQETGWRSWVPWPHVHA
Query Conservation 
 
  


         
                
  
        
  
 
 
                   
   
 
Alig confidence 




























.................






...........















Template Conservation   

  

                    
 .................  

   ...........        
 





Template Sequence  LKRVVWALCFMGSLALLALVCTNRIQYYF. . . . . . . . . . . . . . . . . LYPHVTK. . . . . . . . . . . LDEVAATRLTFPAVTF
Template Known Secondary structure 


T.................T

...........

SS

Template Predicted Secondary structure 
.................

...........







Template SS confidence 















































































   42.......50.........60.........70 ....... ..80.........90...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions