Return to main results Retrieve Phyre Job Id

Job DescriptionP0A858
Confidence23.19%DateThu Jan 5 11:06:58 GMT 2012
Rank229Aligned Residues38
% Identity24%Templatec2pkpA_
PDB info PDB header:lyaseChain: A: PDB Molecule:homoaconitase small subunit; PDBTitle: crystal structure of 3-isopropylmalate dehydratase (leud)2 from methhanocaldococcus jannaschii dsm2661 (mj1271)
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   77..80.........90.........100.........110.........120......
Predicted Secondary structure 














Query SS confidence 

















































Query Sequence  ETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLC
Query Conservation 



 



 
   








  
 


  
  

  

  

 



Alig confidence 
























............












Template Conservation 
 
  

   

 



 





 ............

 

 




  
Template Sequence  EQAVIAIKYCGIKAVIAKSFARIFY. . . . . . . . . . . . RNAINVGLIPIIA
Template Known Secondary structure  TTT

S
B
............T

Template Predicted Secondary structure 




............



Template SS confidence 

















































   68.70.........80.........90.. .......100.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions