Return to main results Retrieve Phyre Job Id

Job DescriptionP52123
Confidence8.92%DateThu Jan 5 12:05:26 GMT 2012
Rank37Aligned Residues20
% Identity55%Templatec3s90D_
PDB info PDB header:cell adhesionChain: D: PDB Molecule:talin-1; PDBTitle: human vinculin head domain vh1 (residues 1-252) in complex with murine2 talin (vbs33; residues 1512-1546)
Resolution1.97 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   262.......270.........280.........290..
Predicted Secondary structure 











Query SS confidence 






























Query Sequence  DFIQMSEFEINNQNKKYRVATMSQDALVDTI
Query Conservation   


 

 
 


 
      



 
 


Alig confidence 



.






..........








Template Conservation 



.






..........








Template Sequence  QFVQ. SAKEVAN. . . . . . . . . . STANLVKTI
Template Known Secondary structure  ...........
Template Predicted Secondary structure  ...........
Template SS confidence 






























   1524... ..1530.... .....1540...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions