Return to main results Retrieve Phyre Job Id

Job DescriptionP52123
Confidence4.62%DateThu Jan 5 12:05:26 GMT 2012
Rank96Aligned Residues28
% Identity7%Templatec2ec5B_
PDB info PDB header:toxinChain: B: PDB Molecule:dermonecrotic toxin; PDBTitle: crystal structures reveal a thiol-protease like catalytic triad in the2 c-terminal region of pasteurella multocida toxin
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   263......270.........280.........290.........300.
Predicted Secondary structure 














Query SS confidence 






































Query Sequence  FIQMSEFEINNQNKKYRVATMSQDALVDTILNQWSLKNE
Query Conservation 


 

 
 


 
      



 
 










 
Alig confidence 










..........










.





Template Conservation 
  

 

  
.......... 
 


 



.

 


Template Sequence  LLRTAMNEMAG. . . . . . . . . . KTSESTADLIR. FALQDT
Template Known Secondary structure  TT..........SS
S
.
T
Template Predicted Secondary structure 

..........



.


Template SS confidence 






































   694.....700.... .....710..... ....720.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions