Return to main results Retrieve Phyre Job Id

Job DescriptionP0A927
Confidence4.61%DateThu Jan 5 11:09:14 GMT 2012
Rank44Aligned Residues37
% Identity24%Templatec3pijA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:beta-fructofuranosidase; PDBTitle: beta-fructofuranosidase from bifidobacterium longum - complex with2 fructose
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   236...240.........250.........260.........270.........280.........
Predicted Secondary structure 




























Query SS confidence 





















































Query Sequence  IASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLV
Query Conservation   
    
         
   


 
     
 
    
 
     


 
 
  
Alig confidence 

















..












...............





Template Conservation 






    
 




..
 

    

   ...............



 
Template Sequence  INDPNGLCFYKGRWHVFY. . QLHPYGTQWGPMH. . . . . . . . . . . . . . . WGHVSS
Template Known Secondary structure  TT..TT
SSS
SB...............
Template Predicted Secondary structure 








..








...............
Template SS confidence 





















































   52.......60......... 70.........80.. ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions