Return to main results Retrieve Phyre Job Id

Job DescriptionP61175
Confidence9.49%DateThu Jan 5 12:07:19 GMT 2012
Rank33Aligned Residues39
% Identity36%Templatec2qq4A_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:iron-sulfur cluster biosynthesis protein iscu; PDBTitle: crystal structure of iron-sulfur cluster biosynthesis2 protein iscu (ttha1736) from thermus thermophilus hb8
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30......... 40.........50.....
Predicted Secondary structure 




............................
Query SS confidence 






















. . . . . . . . . . . . . . . . . . . . . . . . . . . .















Query Sequence  VRLVADLIRGKKVSQALDILTYT. . . . . . . . . . . . . . . . . . . . . . . . . . . . NKKAAVLVKKVLESAI
Query Conservation     
   


  
  
   
   ............................


 
  
 
 
 

 
Alig confidence 






















............................















Template Conservation 

   
 
 



 

  
                    
  
  
     
  

 
   

  

Template Sequence  ASLMTEAVKGKKVAEALELSRKFQAMVVEGAPPDPTLGDLLALQGVAKLPARVKCATLAWHALEEAL
Template Known Secondary structure  TTSBTT




GGGGGGGGGGGGGG
GGG
Template Predicted Secondary structure 













Template SS confidence 


































































   71........80.........90.........100.........110.........120.........130.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions