Return to main results Retrieve Phyre Job Id

Job DescriptionP24251
Confidence18.04%DateThu Jan 5 11:41:37 GMT 2012
Rank8Aligned Residues29
% Identity28%Templated1axib1
SCOP infoImmunoglobulin-like beta-sandwich Fibronectin type III Fibronectin type III
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........80....
Predicted Secondary structure 













Query SS confidence 





































Query Sequence  APEVREFWGWWMELEAQESRFTYSYQFGLFDKAGDWKS
Query Conservation 


 









   
  


 
  
 

  
 
  
Alig confidence 










....












.....




Template Conservation 

  






....
  
   
 
   .....    
Template Sequence  SPERETFSCHW. . . . TDEGPIQLFYTRR. . . . . NEWKE
Template Known Secondary structure  BSSSS
....



S

.....


Template Predicted Secondary structure 




....





.....

Template SS confidence 





































   40.........50 .........60... .....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions