Return to main results Retrieve Phyre Job Id

Job DescriptionP77234
Confidence21.37%DateThu Jan 5 12:26:39 GMT 2012
Rank110Aligned Residues33
% Identity30%Templated2jq9a1
SCOP infoSpectrin repeat-like MIT domain MIT domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   260.........270.........280.........290.........300.........
Predicted Secondary structure 











Query SS confidence 

















































Query Sequence  YQAAFEWFTKAAECNDATAWYNLAIMYHYGEGRPVDLRQALDLYRKVQSS
Query Conservation     
      

  
   
   

  
  
 

  
   
   
 


  
Alig confidence 















.................
















Template Conservation 
  
      

  
 .................   
  
   
  


 
Template Sequence  LQKAIDLVTKATEEDK. . . . . . . . . . . . . . . . . AKNYEEALRLYQHAVEY
Template Known Secondary structure  .................TT
Template Predicted Secondary structure  .................

Template SS confidence 

















































   6...10.........20. ........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions