Return to main results Retrieve Phyre Job Id

Job DescriptionP25516
Confidence10.73%DateThu Jan 5 11:41:52 GMT 2012
Rank80Aligned Residues29
% Identity28%Templatec2kmfA_
PDB info PDB header:photosynthesisChain: A: PDB Molecule:photosystem ii 11 kda protein; PDBTitle: solution structure of psb27 from cyanobacterial photosystem2 ii
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   186...190.........200.........210.........220.....
Predicted Secondary structure 

























Query SS confidence 







































Query Sequence  EYLGKAVWSELQDGEWIAYPDTLVGTDSHTTMINGLGVLG
Query Conservation 
 
  

          
 










   



 

Alig confidence 




...........























Template Conservation 
 

 ...........

    
 
  

  
 



 

Template Sequence  DYISR. . . . . . . . . . . YRRKGDAGGLKSFTTMQTALNSLA
Template Known Secondary structure  ...........T
SSS
Template Predicted Secondary structure  ...........







Template SS confidence 







































   48.50.. .......60.........70......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions