Return to main results Retrieve Phyre Job Id

Job DescriptionP25516
Confidence10.72%DateThu Jan 5 11:41:52 GMT 2012
Rank81Aligned Residues43
% Identity21%Templatec1b70A_
PDB info PDB header:ligaseChain: A: PDB Molecule:phenylalanyl-trna synthetase; PDBTitle: phenylalanyl trna synthetase complexed with phenylalanine
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   176...180.........190.........200.........210........ .220.........230.........
Predicted Secondary structure 

























....







Query SS confidence 










































. . . .




















Query Sequence  GTGICHQVNLEYLGKAVWSELQDGEWIAYPDTLVGTDSHTTMI. . . . NGLGVLGWGVGGIEAEAAMLG
Query Conservation 
 

 


 

 
  

          
 










   ....



 

 






   
 
Alig confidence 










.....................










....




















Template Conservation 
 
   
 

 .....................  
                
 
 








   
Template Sequence  GAGMVHPKVFQ. . . . . . . . . . . . . . . . . . . . . AVDAYRERLGLPPAYRGVTGFAFGLGVERLAMLRYG
Template Known Secondary structure 
.....................TT




TT
T
Template Predicted Secondary structure 





.....................

















Template SS confidence 



































































   282.......290.. .......300.........310.........320........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions