Return to main results Retrieve Phyre Job Id

Job DescriptionP41068
Confidence2.94%DateThu Jan 5 12:01:24 GMT 2012
Rank56Aligned Residues29
% Identity34%Templatec2zagB_
PDB info PDB header:transferaseChain: B: PDB Molecule:oligosaccharyl transferase stt3 subunit related protein; PDBTitle: crystal structure of the semet-substituted soluble domain of stt3 from2 p. furiosus
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   164.....170.... .....180.. .......190..
Predicted Secondary structure 






..



.......




Query SS confidence 










. .







. . . . . . .









Query Sequence  TEDASLPGKIR. . KCPVYLPD. . . . . . . DRTNRNNGDK
Query Conservation   
      
  ..   
    .......       


Alig confidence 










..







.......









Template Conservation   
 



 
 
 
    
 
  

 





  




Template Sequence  GENIQLKEGENTVKVRAELPEGVISSYKDELQRKYGDK
Template Known Secondary structure 
SB



TTTTGGG
Template Predicted Secondary structure 











Template SS confidence 





































   900.........910.........920.........930.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions