Return to main results Retrieve Phyre Job Id

Job DescriptionP22707
Confidence6.43%DateThu Jan 5 11:39:03 GMT 2012
Rank37Aligned Residues48
% Identity21%Templatec2c7jB_
PDB info PDB header:electron transportChain: B: PDB Molecule:phycoerythrocyanin beta chain; PDBTitle: phycoerythrocyanin from mastigocladus laminosus, 295 k,2 3.0 a
Resolution3.0 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   73......80.........90.........100.........110.........120.........130..... ....140
Predicted Secondary structure 
















.

Query SS confidence 






























































.




Query Sequence  LDDAVNTLKPWWPGLFDGDTPRLLACGIRDVLLEDVAQRNIPLSHKKLRRALKAITRSESYLC. AMKAG
Query Conservation      
  
    
 

     






 


          

   

 

  

 
 


 .    
Alig confidence 





















....................




















.




Template Conservation 
  
   
    
 
   

  ....................
   
   
 

    

  






Template Sequence  VANAYRALVAERPQVFNPGGPC. . . . . . . . . . . . . . . . . . . . FHHRNQAACIRDLGFILRYVTYSVLAG
Template Known Secondary structure  SGGGGSTTSTT....................
ST
Template Predicted Secondary structure 










....................


Template SS confidence 




































































   52.......60.........70... ......80.........90.........100
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions