Return to main results Retrieve Phyre Job Id

Job DescriptionP37338
Confidence74.86%DateThu Jan 5 11:55:19 GMT 2012
Rank257Aligned Residues35
% Identity6%Templatec1r71B_
PDB info PDB header:transcription/dnaChain: B: PDB Molecule:transcriptional repressor protein korb; PDBTitle: crystal structure of the dna binding domain of korb in2 complex with the operator dna
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40.........50.
Predicted Secondary structure 













Query SS confidence 












































Query Sequence  DGYRWLKNDIIRGNFQPDEKLRMSLLTSRYALGVGPLREALSQLV
Query Conservation   

  
   
  
 
  
  
 
 


   



 





  
 
Alig confidence 







..........


























Template Conservation       
  .......... 
 
  


  

 
 
 

  
 
  
Template Sequence  DFIGRELA. . . . . . . . . . KGKKKGDIAKEIGKSPAFITQHVTLLD
Template Known Secondary structure  ..........TT

TT

GGGS
Template Predicted Secondary structure  ..........







Template SS confidence 












































   159160...... ...170.........180.........190...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions