Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB43
Confidence4.07%DateThu Jan 5 11:14:35 GMT 2012
Rank73Aligned Residues28
% Identity29%Templatec1urzC_
PDB info PDB header:virus/viral proteinChain: C: PDB Molecule:envelope protein; PDBTitle: low ph induced, membrane fusion conformation of the2 envelope protein of tick-borne encephalitis virus
Resolution2.7 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10...... ...20........
Predicted Secondary structure 







..........





Query SS confidence 















. . . . . . . . . .











Query Sequence  MFCVIYRSSKRDQTYL. . . . . . . . . . YVEKKDDFSRVP
Query Conservation 


 



 

  


..........

 
 
 
  

Alig confidence 















..........











Template Conservation 
 

  

 
                


 
 

 

 
Template Sequence  LLCRVASGVDLAQTVILELDKTLPTAWQVHRDWFNDLA
Template Known Secondary structure  SS
GGG





T

Template Predicted Secondary structure 















Template SS confidence 





































   184.....190.........200.........210.........220.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions