Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC53
Confidence97.08%DateThu Jan 5 11:17:11 GMT 2012
Rank20Aligned Residues130
% Identity14%Templatec2nvwB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:galactose/lactose metabolism regulatory protein PDBTitle: crystal sctucture of transcriptional regulator gal80p from2 kluyveromymes lactis
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10........ .20.........30.........40.........50.........60.........70.........
Predicted Secondary structure 










..



















Query SS confidence 
















. .




























































Query Sequence  AVTQTAQACDLVIFGAK. . GDLARRKLLPSLYQLEKAGQLNPDTRIIGVGRADWDKAAYTKVVREALETFMKETIDEGLW
Query Conservation             





..



 


 


  
   
 
     


 

   
 
 

  
   
             
Alig confidence 
















..














......










.......................





Template Conservation          






 
         
  
    ......    




 
.......................     
Template Sequence  HMLASSRPIRVGFVGLTSGKSWVAKTHFLAIQQL. . . . . . SSQFQIVALYN. . . . . . . . . . . . . . . . . . . . . . . PTLKSS
Template Known Secondary structure 





S
S

STTSTT......TTT
.......................SS
Template Predicted Secondary structure 














......




.......................

Template SS confidence 















































































  
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions