Return to main results Retrieve Phyre Job Id

Job DescriptionQ47013
Confidence4.23%DateThu Jan 5 12:36:09 GMT 2012
Rank95Aligned Residues35
% Identity11%Templated1y0na_
SCOP infoYehU-like YehU-like YehU-like
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   27..30.........40.........50.........60.........70.....
Predicted Secondary structure 











Query SS confidence 
















































Query Sequence  VTEELLQSLKKTALSGDEESIELLHNIALGYDKFGKEAEDILYHIVRTP
Query Conservation 

 
 



   
  

 











 
  

 

 








Alig confidence 


















..............















Template Conservation 
  


  










..............

 

 

  

  
 
Template Sequence  LEADTLNNLLEDFVTRETP. . . . . . . . . . . . . . LDVRVERARHALRRGE
Template Known Secondary structure  S




..............TTS
Template Predicted Secondary structure 





..............


Template SS confidence 
















































   8.10.........20...... ...30.........40..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions