Return to main results Retrieve Phyre Job Id

Job DescriptionQ47013
Confidence4.57%DateThu Jan 5 12:36:09 GMT 2012
Rank73Aligned Residues36
% Identity22%Templatec3qi7A_
PDB info PDB header:transcriptionChain: A: PDB Molecule:putative transcriptional regulator; PDBTitle: crystal structure of a putative transcriptional regulator2 (yp_001089212.1) from clostridium difficile 630 at 1.86 a resolution
Resolution1.86 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   249250.........260.........270.........280.........290.........300......
Predicted Secondary structure 












Query SS confidence 

























































Query Sequence  QIKCVIFNSLRALGYDKENSLKRVINSFNSELMGEMSNNNIKVHLNEPEIIFLHADLQ
Query Conservation   







   
    

    

         
 
 
 

    
 

 


 


Alig confidence 









......................

























Template Conservation   





  
......................  

  
  












    
Template Sequence  EVQAIVVSTD. . . . . . . . . . . . . . . . . . . . . . QAGLLPALQKVKEKRPEIITISAPXG
Template Known Secondary structure  T
S......................S



TTSSS

Template Predicted Secondary structure 




......................










Template SS confidence 

























































   111........120 .........130.........140......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions