Return to main results Retrieve Phyre Job Id

Job DescriptionP52043
Confidence28.70%DateWed Jan 25 15:20:57 GMT 2012
Rank48Aligned Residues27
% Identity33%Templatec3iukB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of putative bacterial protein of unknown function2 (duf885, pf05960.1, ) from arthrobacter aurescens tc1, reveals fold3 similar to that of m32 carboxypeptidases
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   457..460.........470.........480.........490
Predicted Secondary structure 











Query SS confidence 

































Query Sequence  YLHRYLENAPGGHIHHDLSHVFDLHRNLIATGSM
Query Conservation   
   
        
                
  
Alig confidence 










....



...











Template Conservation   

  
   

....



... 


 

  
  
Template Sequence  QIRAELESREG. . . . FDLK. . . SFHSKALNIGSV
Template Known Secondary structure  TSTT....

...T
S
Template Predicted Secondary structure 
....

...



Template SS confidence 

































   523......530... .... ..540.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions