Return to main results Retrieve Phyre Job Id

Job DescriptionP00562
Confidence80.41%DateThu Jan 5 10:56:45 GMT 2012
Rank313Aligned Residues29
% Identity28%Templatec3eywA_
PDB info PDB header:transport proteinChain: A: PDB Molecule:c-terminal domain of glutathione-regulated potassium-efflux PDBTitle: crystal structure of the c-terminal domain of e. coli kefc in complex2 with keff
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   459460.........470.........480.........490.....
Predicted Secondary structure 







Query SS confidence 




































Query Sequence  IGLVLFGKGNIGSRWLELFAREQSTLSARTGFEFVLA
Query Conservation 
 
 
 
 
 

      
      
    
  
 
 
Alig confidence 





















........






Template Conservation 




 
 




 


 
   ........
  



Template Sequence  MRVIIAGFGRFGQITGRLLLSS. . . . . . . . GVKMVVL
Template Known Secondary structure 



ST........T

Template Predicted Secondary structure 




........


Template SS confidence 




































   400.........410.........420. .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions