Return to main results Retrieve Phyre Job Id

Job DescriptionP18005
Confidence8.42%DateThu Jan 5 11:36:31 GMT 2012
Rank41Aligned Residues27
% Identity19%Templatec1t6fA_
PDB info PDB header:cell cycleChain: A: PDB Molecule:geminin; PDBTitle: crystal structure of the coiled-coil dimerization motif of2 geminin
Resolution1.47 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   219220.........230.........240.........250.........260.........270..
Predicted Secondary structure 
























Query SS confidence 





















































Query Sequence  TTWQRVQENMIKGGLSGRSASGKNTRTRAITGIDGDIRINKALWVIAEQFRKWK
Query Conservation    





 




            

 
 


    





 


     
Alig confidence 









...........................
















Template Conservation 

   




...........................






 

 


 

Template Sequence  TLYEALKENE. . . . . . . . . . . . . . . . . . . . . . . . . . . KLHKEIEQKDNEIARLK
Template Known Secondary structure 
...........................
Template Predicted Secondary structure 
...........................
Template SS confidence 





















































   1........10 .........20.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions