Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7K6
Confidence7.52%DateThu Jan 5 11:05:50 GMT 2012
Rank96Aligned Residues29
% Identity24%Templatec3qiiA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:phd finger protein 20; PDBTitle: crystal structure of tudor domain 2 of human phd finger protein 20
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1920.........30.........40.........50....
Predicted Secondary structure 














Query SS confidence 



































Query Sequence  SFRPGDTVEVKVWVVEGSKKRLQAFEGVVIAIRNRG
Query Conservation   
  

 
 
   
 

 
 
 
 
 



     
Alig confidence 











..



.....












Template Conservation 

 

  
 


.. 

 ..... 
 
 
  
    
Template Sequence  EFQINEQVLACW. . SDCR. . . . . FYPAKVTAVNKDG
Template Known Secondary structure 


TT

..TTS
.....
TTS
Template Predicted Secondary structure 






..


.....



Template SS confidence 



































   86...90....... ..100. ........110....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions