Return to main results Retrieve Phyre Job Id

Job DescriptionP76472
Confidence10.73%DateWed Jan 25 15:21:08 GMT 2012
Rank94Aligned Residues26
% Identity23%Templated1p6va_
SCOP infoSmall protein B (SmpB) Small protein B (SmpB) Small protein B (SmpB)
Resolution3.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   230.........240.........250.........260...
Predicted Secondary structure 










Query SS confidence 

































Query Sequence  YTIHAEVEGCAYQHNFVDLLKRAAQEGVTFCPLS
Query Conservation 



       
  

  

  
   

 



 
Alig confidence 



........





















Template Conservation 



........
 

 

      

 




 
Template Sequence  LLLH. . . . . . . . KREIMRLYGKVQEKGYTIIPLK
Template Known Secondary structure  B


........

Template Predicted Secondary structure  ........



Template SS confidence 

































   85... .90.........100.........110
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions