Return to main results Retrieve Phyre Job Id

Job DescriptionP60651
Confidence32.58%DateThu Jan 5 12:07:00 GMT 2012
Rank26Aligned Residues26
% Identity23%Templated1tifa_
SCOP infobeta-Grasp (ubiquitin-like) Translation initiation factor IF3, N-terminal domain Translation initiation factor IF3, N-terminal domain
Resolution1.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   250.........260.........270.........280.
Predicted Secondary structure 











Query SS confidence 































Query Sequence  LTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQ
Query Conservation 
   
   

  
    


 



  
  
 
Alig confidence 












......












Template Conservation      


  
   ...... 



 
   
 
Template Sequence  KSKQEALEIAARR. . . . . . NLDLVLVAPNAKP
Template Known Secondary structure  T......T
TTSSS
Template Predicted Secondary structure 


......








Template SS confidence 































   2930.........40. ........50....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions