Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF26
Confidence1.55%DateThu Jan 5 11:24:58 GMT 2012
Rank88Aligned Residues38
% Identity32%Templatec3e6yB_
PDB info PDB header:signaling proteinChain: B: PDB Molecule:14-3-3-like protein c; PDBTitle: structure of 14-3-3 in complex with the differentiation-inducing agent2 cotylenin a
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   111........120.... .....130.. .......140........
Predicted Secondary structure 



.....
..............
Query SS confidence 













. . . . .







. . . . . . . . . . . . . .















Query Sequence  PDHLPLYLEYLAQL. . . . . PQSEAVEG. . . . . . . . . . . . . . LKDIAPILALLSARLQ
Query Conservation 




  




 
.....   

  
..............
      
  
   
 
Alig confidence 













.....







..............















Template Conservation 
 



 

 


 


      
  


 


 

  

   
   








 
Template Sequence  PIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAEEESYKDSTLIMQLLRDNLT
Template Known Secondary structure  TS

TT


S
Template Predicted Secondary structure 


Template SS confidence 
























































   174.....180.........190.........200.........210.........220.........230
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions