Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF26
Confidence1.67%DateThu Jan 5 11:24:58 GMT 2012
Rank82Aligned Residues31
% Identity42%Templatec2ilrA_
PDB info PDB header:oncoproteinChain: A: PDB Molecule:fanconi anemia group e protein; PDBTitle: crystal structure of human fanconi anemia protein e c-2 terminal domain
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   106...110.... .....120.........130......
Predicted Secondary structure 






..................


Query SS confidence 








. . . . . . . . . . . . . . . . . .





















Query Sequence  NSRELPDHL. . . . . . . . . . . . . . . . . . PLYLEYLAQLPQSEAVEGLKDI
Query Conservation     





..................
  




 
   

  

   
Alig confidence 








..................





















Template Conservation   
  

  
      

  
          
  
    
 


 

  
Template Sequence  ESLELPKAIQDQLPRLQQLLKTLEEAPPVELQLLHECSPSQMDLLCAQL
Template Known Secondary structure 









GGGG

Template Predicted Secondary structure 












Template SS confidence 
















































   276...280.........290.........300.........310.........320....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions