Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8H6
Confidence10.28%DateThu Jan 5 11:07:51 GMT 2012
Rank38Aligned Residues22
% Identity45%Templated1tc3c_
SCOP infoDNA/RNA-binding 3-helical bundle Homeodomain-like Recombinase DNA-binding domain
Resolution2.45

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   118.120.........130.........140.......
Predicted Secondary structure 








Query SS confidence 





























Query Sequence  GETLSAEEQSWVDAKLDRIDELMQKLGLSY
Query Conservation 

 

  

 


  
 
   

  


  
Alig confidence 












........








Template Conservation 

 


 
 
 

........ 

  
 
 
Template Sequence  GSALSDTERAQLD. . . . . . . . VMKLLNVSL
Template Known Secondary structure  S



........TT

Template Predicted Secondary structure 
........


Template SS confidence 





























   204.....210...... ...220.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions