Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8H6
Confidence7.38%DateThu Jan 5 11:07:51 GMT 2012
Rank47Aligned Residues28
% Identity25%Templatec3t76A_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcriptional regulator vanug; PDBTitle: crystal structure of transcriptional regulator vanug, form ii
Resolution1.12 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   112.......120.........130.........140.........
Predicted Secondary structure 











Query SS confidence 





































Query Sequence  LERLEAGETLSAEEQSWVDAKLDRIDELMQKLGLSYDD
Query Conservation 




 

 

  

 


  
 
   

  


  

Alig confidence 










..........
















Template Conservation 
  

 
   
..........   
  
   
 
   
Template Sequence  FAKLGKNENVS. . . . . . . . . . LTVLLAICEYLNCDFGD
Template Known Secondary structure  TT



..........T

GGG
Template Predicted Secondary structure 





..........


Template SS confidence 





































   33......40... ......50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions