Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8H6
Confidence4.46%DateThu Jan 5 11:07:51 GMT 2012
Rank73Aligned Residues23
% Identity39%Templatec1zrvA_
PDB info PDB header:antimicrobial protein, antibioticChain: A: PDB Molecule:spinigerin; PDBTitle: solution structure of spinigerin in h20/tfe 50%
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   129130.........140.........150.........160........
Predicted Secondary structure 












Query SS confidence 







































Query Sequence  VDAKLDRIDELMQKLGLSYDDDEEEEEDEKQEDMMRLLRG
Query Conservation 

  
 
   

  


  


  

          
   
Alig confidence 















.................






Template Conservation 















.................






Template Sequence  VDKKVADKVLLLKQLR. . . . . . . . . . . . . . . . . IMRLLTR
Template Known Secondary structure 

.................T
Template Predicted Secondary structure 
.................
Template SS confidence 







































   2.......10....... ..20....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions