Return to main results Retrieve Phyre Job Id

Job DescriptionP45760
Confidence7.17%DateThu Jan 5 12:03:37 GMT 2012
Rank16Aligned Residues28
% Identity21%Templatec1p58F_
PDB info PDB header:virusChain: F: PDB Molecule:envelope protein m; PDBTitle: complex organization of dengue virus membrane proteins as revealed by2 9.5 angstrom cryo-em reconstruction
Resolution9.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10...... ...20.........30
Predicted Secondary structure 





.........
Query SS confidence 













. . . . . . . . .













Query Sequence  KQSGMTLLEVLLAM. . . . . . . . . SIFTAVALTLMSSM
Query Conservation   
 










......... 
 

    
    
Alig confidence 













.........













Template Conservation 





  
  
   


   




 





 

 
Template Sequence  RHPGFTIMAAILAYTIGTTHFQRVLIFILLTAIAPSM
Template Known Secondary structure 
STTTGGGTTSSSTT
Template Predicted Secondary structure 







Template SS confidence 




































   38.40.........50.........60.........70....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions