Return to main results Retrieve Phyre Job Id

Job DescriptionP64599
Confidence2.15%DateThu Jan 5 12:09:49 GMT 2012
Rank91Aligned Residues30
% Identity27%Templated1p7ga2
SCOP infoFe,Mn superoxide dismutase (SOD), C-terminal domain Fe,Mn superoxide dismutase (SOD), C-terminal domain Fe,Mn superoxide dismutase (SOD), C-terminal domain
Resolution1.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   125....130.........140.........150.........160.........
Predicted Secondary structure 


Query SS confidence 












































Query Sequence  GLYVKNLMDAIELEQMPKALRMMLLQLADFVEAGMKTAPETKQTS
Query Conservation   
 





 

 
         
   
  
              
Alig confidence 













...............















Template Conservation    

   
  


 ............... 
  
   
       
Template Sequence  GSYVDNWWNVVNWD. . . . . . . . . . . . . . . DVERRLQKALNGQIAL
Template Known Secondary structure  GGG

...............TT


S
Template Predicted Secondary structure 

...............




Template SS confidence 












































   191........200.... .....210.........220
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions