Return to main results Retrieve Phyre Job Id

Job DescriptionP64599
Confidence2.78%DateThu Jan 5 12:09:49 GMT 2012
Rank57Aligned Residues28
% Identity25%Templatec1p7gL_
PDB info PDB header:oxidoreductaseChain: L: PDB Molecule:superoxide dismutase; PDBTitle: crystal structure of superoxide dismutase from pyrobaculum2 aerophilum
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   127..130.........140.........150.........160.........
Predicted Secondary structure 


Query SS confidence 










































Query Sequence  YVKNLMDAIELEQMPKALRMMLLQLADFVEAGMKTAPETKQTS
Query Conservation   





 

 
         
   
  
              
Alig confidence 











...............















Template Conservation 

  

  


 ............... 
  
   
       
Template Sequence  YVDNWWNVVNWD. . . . . . . . . . . . . . . DVERRLQKALNGQIAL
Template Known Secondary structure  GGGB
...............TT

S
Template Predicted Secondary structure 

...............





Template SS confidence 










































   193......200.... .....210.........220
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions