Return to main results Retrieve Phyre Job Id

Job DescriptionP64599
Confidence2.93%DateThu Jan 5 12:09:49 GMT 2012
Rank51Aligned Residues29
% Identity17%Templatec1cojA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:protein (superoxide dismutase); PDBTitle: fe-sod from aquifex pyrophilus, a hyperthermophilic bacterium
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   125....130.........140.........150.........160........
Predicted Secondary structure 

Query SS confidence 











































Query Sequence  GLYVKNLMDAIELEQMPKALRMMLLQLADFVEAGMKTAPETKQT
Query Conservation   
 





 

 
         
   
  
             
Alig confidence 













...............














Template Conservation    

      


 ............... 
  

  
      
Template Sequence  PPYIDAFFKNINWD. . . . . . . . . . . . . . . VVNERFEKAMKAYEA
Template Known Secondary structure  TBB...............
Template Predicted Secondary structure 

...............
Template SS confidence 











































   178.180.........190. ........200......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions