Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9S1
Confidence35.81%DateWed Jan 25 15:20:20 GMT 2012
Rank289Aligned Residues45
% Identity16%Templatec2ydyA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:methionine adenosyltransferase 2 subunit beta; PDBTitle: crystal structure of human s-adenosylmethionine synthetase2 2, beta subunit in orthorhombic crystal form
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   31........40.........50.........60.........70.........80.........90..
Predicted Secondary structure 



















Query SS confidence 





























































Query Sequence  QKALIVTDKTLVQCGVVAKVTDKMDAAGLAWAIYDGVVPNPTITVVKEGLGVFQNSGADYLI
Query Conservation     



            
   
   

       
   
    
            
 

Alig confidence 










....




















.............












Template Conservation 









 ....

  
   
   
  
    
.............   
     
 

Template Sequence  RRVLVTGATGL. . . . LGRAVHKEFQQNNWHAVGCGV. . . . . . . . . . . . . HHIIHDFQPHVIV
Template Known Secondary structure 
TTTS....TTT


.............

S
Template Predicted Secondary structure 




....


.............



Template SS confidence 





























































   2930......... 40.........50.........60 .........70...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions