Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9S1
Confidence70.53%DateWed Jan 25 15:20:20 GMT 2012
Rank144Aligned Residues47
% Identity17%Templatec1z0zC_
PDB info PDB header:transferaseChain: C: PDB Molecule:probable inorganic polyphosphate/atp-nad kinase; PDBTitle: crystal structure of a nad kinase from archaeoglobus2 fulgidus in complex with nad
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60.........70.........80.........90......
Predicted Secondary structure 




















Query SS confidence 
































































Query Sequence  KALIVTDKTLVQCGVVAKVTDKMDAAGLAWAIYDGVVPNPTITVVKEGLGVFQNSGADYLIAIGG
Query Conservation    



            
   
   

       
   
    
            
 





Alig confidence 








....


























..............










Template Conservation 
  

 
  ....     
   
                 ..............   
 

 


Template Sequence  RAAVVYKTD. . . . GHVKRIEEALKRLEVEVELFNQPSEEL. . . . . . . . . . . . . . ENFDFIVSVGG
Template Known Secondary structure  SSS....STTTT
SS

GGG..............GGSSSS
Template Predicted Secondary structure 


....






..............





Template SS confidence 
































































   2.......10 .........20.........30....... ..40........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions