Return to main results Retrieve Phyre Job Id

Job DescriptionP30143
Confidence4.35%DateThu Jan 5 11:46:07 GMT 2012
Rank70Aligned Residues24
% Identity13%Templatec2h1xB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:5-hydroxyisourate hydrolase (formerly known as PDBTitle: crystal structure of 5-hydroxyisourate hydrolase (formerly2 known as trp, transthyretin related protein)
Resolution1.98 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   438.440.........450.........460........
Predicted Secondary structure 


















Query SS confidence 






























Query Sequence  ASDYLRQRKLGVRPVFDPLRYPDIGRQLSPD
Query Conservation   


    
 
  
 
     
         
Alig confidence 









.......













Template Conservation 
  

   
 .......  
 
 
 
 
 
 
Template Sequence  TGKYWDALGE. . . . . . . TCFYPYVEIVFTIT
Template Known Secondary structure  TTT
.......

S
S

Template Predicted Secondary structure 


.......





Template SS confidence 






























   73......80.. .......90......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions