Return to main results Retrieve Phyre Job Id

Job DescriptionP75883
Confidence36.00%DateThu Jan 5 12:15:35 GMT 2012
Rank34Aligned Residues28
% Identity18%Templatec2zxeA_
PDB info PDB header:hydrolase/transport proteinChain: A: PDB Molecule:na, k-atpase alpha subunit; PDBTitle: crystal structure of the sodium - potassium pump in the e2.2k+.pi2 state
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   185....190.........200.........210.........220
Predicted Secondary structure 























Query SS confidence 



































Query Sequence  KNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWL
Query Conservation     
 

  

 
     
 
      
 


 
 
Alig confidence 







.









.......









Template Conservation       
 
.

    
 
 ....... 

 



 
Template Sequence  PQQALVIR. DGEKSTINAE. . . . . . . FVVAGDLVEV
Template Known Secondary structure 
S.TTGG.......G

TT
Template Predicted Secondary structure 

.

.......




Template SS confidence 



































   166...170... ......180... ......190...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions