Return to main results Retrieve Phyre Job Id

Job DescriptionP75883
Confidence35.29%DateThu Jan 5 12:15:35 GMT 2012
Rank37Aligned Residues29
% Identity24%Templatec2hc8A_
PDB info PDB header:transport proteinChain: A: PDB Molecule:cation-transporting atpase, p-type; PDBTitle: structure of the a. fulgidus copa a-domain
Resolution1.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   185....190.........200.........210.........220.
Predicted Secondary structure 
























Query SS confidence 




































Query Sequence  KNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWLG
Query Conservation     
 

  

 
     
 
      
 


 
 

Alig confidence 







.









.......










Template Conservation 
    
 
. 
    
   ....... 
  



 
 
Template Sequence  AKTAVVIR. DGKEIAVPVE. . . . . . . EVAVGDIVIVR
Template Known Secondary structure 
S.TTGG.......G

TT

Template Predicted Secondary structure 

.

.......





Template SS confidence 




































   224.....230. ........240. ........250..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions