Return to main results Retrieve Phyre Job Id

Job DescriptionP18956
Confidence72.47%DateThu Jan 5 11:37:12 GMT 2012
Rank24Aligned Residues27
% Identity33%Templatec1w7pD_
PDB info PDB header:protein transportChain: D: PDB Molecule:vps36p, ylr417w; PDBTitle: the crystal structure of endosomal complex escrt-ii2 (vps22/vps25/vps36)
Resolution3.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   240.........250..... ....260.......
Predicted Secondary structure 


.........





Query SS confidence 















. . . . . . . . .











Query Sequence  DEFYKGTIAEQIAQEM. . . . . . . . . QKNGGLITKEDL
Query Conservation    

 
 

  

   .........   

 

  

Alig confidence 




.









.........











Template Conservation   

  .


 

 
             




 
 

Template Sequence  ELFLD. EIAREIYEFTLSEFKDLNSDTNYMIITLVDL
Template Known Secondary structure  .TT

SS
S



Template Predicted Secondary structure  .







Template SS confidence 




































   405.... 410.........420.........430.........440
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions