Return to main results Retrieve Phyre Job Id

Job DescriptionP18956
Confidence69.75%DateThu Jan 5 11:37:12 GMT 2012
Rank25Aligned Residues27
% Identity37%Templatec1u5tB_
PDB info PDB header:transport proteinChain: B: PDB Molecule:defective in vacuolar protein sorting; vps36p; PDBTitle: structure of the escrt-ii endosomal trafficking complex
Resolution3.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   240.........250....... ..260.......
Predicted Secondary structure 


.........





Query SS confidence 

















. . . . . . . . .









Query Sequence  DEFYKGTIAEQIAQEMQK. . . . . . . . . NGGLITKEDL
Query Conservation    

 
 

  

     ......... 

 

  

Alig confidence 




.











.........









Template Conservation   

  .


 

 
             




 
 

Template Sequence  ELFLD. EIAREIYEFTLSEFKDLNSDTNYMIITLVDL
Template Known Secondary structure  TT.TTTTTSSS





TT
Template Predicted Secondary structure  .








Template SS confidence 




































   405.... 410.........420.........430.........440
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions