Return to main results Retrieve Phyre Job Id

Job DescriptionP0C8J8
Confidence20.26%DateThu Jan 5 11:30:06 GMT 2012
Rank134Aligned Residues31
% Identity26%Templated1nd9a_
SCOP infoPutative DNA-binding domain Putative DNA-binding domain N-terminal subdomain of bacterial translation initiation factor IF2
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100.........110.........120.....
Predicted Secondary structure 



















Query SS confidence 

























































Query Sequence  VFTIADKVGFARERIILGGDHLGPNCWQQENADAAMEKSVELVKEYVRAGFSKIHLDA
Query Conservation 
   
         
 







  
  
    

  

 

   
 


  



 
Alig confidence 










...........................



















Template Conservation 
  

 

  
...........................







 



 

  
 
Template Sequence  IKTLAAERQTS. . . . . . . . . . . . . . . . . . . . . . . . . . . VERLVQQFADAGIRKSADDS
Template Known Secondary structure  TTSSS...........................TS

SSSS
Template Predicted Secondary structure 


...........................








Template SS confidence 

























































   6...10...... ...20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions