Return to main results Retrieve Phyre Job Id

Job DescriptionP0C8J8
Confidence24.50%DateThu Jan 5 11:30:06 GMT 2012
Rank113Aligned Residues35
% Identity9%Templatec1vm6B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:dihydrodipicolinate reductase; PDBTitle: crystal structure of dihydrodipicolinate reductase (tm1520) from2 thermotoga maritima at 2.27 a resolution
Resolution2.27 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50.........60.......
Predicted Secondary structure 













Query SS confidence 













































Query Sequence  AHPLVIEAALAFDRNSTRKVLIEATSNQVNQFGGYTGMTPADFREF
Query Conservation 
 
 

 


  
 
   






 



  







 

   
Alig confidence 





















...........












Template Conservation 
 
               
 

...........



        
Template Sequence  SSPEALPKTVDLCKKYRAGLVL. . . . . . . . . . . GTTALKEEHLQML
Template Known Secondary structure  S
GGGT
...........


S

Template Predicted Secondary structure 





...........




Template SS confidence 













































   4950.........60.........70 .........80...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions