Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABA6
Confidence17.62%DateThu Jan 5 11:15:03 GMT 2012
Rank42Aligned Residues39
% Identity10%Templatec3m8yC_
PDB info PDB header:isomeraseChain: C: PDB Molecule:phosphopentomutase; PDBTitle: phosphopentomutase from bacillus cereus after glucose-1,6-bisphosphate2 activation
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60.........70.........80.........90
Predicted Secondary structure 
























Query SS confidence 



















































Query Sequence  MAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRGLCGG
Query Conservation        
   
      
                      










 
Alig confidence 






















............





.









Template Conservation     
   
   
  

 

  

............





.





    
Template Sequence  PQGYGEALQEYDARLPEVFAKLK. . . . . . . . . . . . EDDLLL. ITADHGNDPI
Template Known Secondary structure  TT

............TT.
SSB

TT
Template Predicted Secondary structure 
............


.







Template SS confidence 



















































   295....300.........310....... ..320... ......330...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions