Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABA6
Confidence7.99%DateThu Jan 5 11:15:03 GMT 2012
Rank75Aligned Residues39
% Identity18%Templatec3igzB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:cofactor-independent phosphoglycerate mutase; PDBTitle: crystal structures of leishmania mexicana phosphoglycerate2 mutase at low cobalt concentration
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   35....40.........50.........60.........70.........80.........
Predicted Secondary structure 























Query SS confidence 






















































Query Sequence  SQDRMAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRGLCG
Query Conservation            
   
      
                      










Alig confidence 

























................












Template Conservation    
 
 


 

  







   
................












Template Sequence  LKATITGVEAVDESLAKLKDAVDSVN. . . . . . . . . . . . . . . . GVYIVTADHGNSD
Template Known Secondary structure  TT................

SSBSTT
Template Predicted Secondary structure 

................







Template SS confidence 






















































   433......440.........450........ .460.........470.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions