Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABA6
Confidence33.91%DateThu Jan 5 11:15:03 GMT 2012
Rank25Aligned Residues36
% Identity14%Templatec2zktB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:2,3-bisphosphoglycerate-independent phosphoglycerate PDBTitle: structure of ph0037 protein from pyrococcus horikoshii
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60.........70.........80......
Predicted Secondary structure 




















Query SS confidence 















































Query Sequence  MAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRG
Query Conservation        
   
      
                      







Alig confidence 

























............









Template Conservation     
 
 
  

  




  
  

............









Template Sequence  PKLKAELIERADRMIGYILDHVDLEE. . . . . . . . . . . . VVIAITGDHS
Template Known Secondary structure  TT

TTT............
SSB
Template Predicted Secondary structure 

............



Template SS confidence 















































   313......320.........330........ .340........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions