Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABA6
Confidence7.39%DateThu Jan 5 11:15:03 GMT 2012
Rank79Aligned Residues45
% Identity4%Templatec1ew2A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:phosphatase; PDBTitle: crystal structure of a human phosphatase
Resolution1.82 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2930.........40.........50.........60.........70.........80.........90
Predicted Secondary structure 
























Query SS confidence 





























































Query Sequence  ASKMRKSQDRMAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRGLCGG
Query Conservation 



 
          
   
      
                      










 
Alig confidence 



























................













.


Template Conservation 
 
 

    
 
 
 

 

  
    ................   










. 
 
Template Sequence  GHHESRAYRALTETIMFDDAIERAGQLT. . . . . . . . . . . . . . . . SEEDTLSLVTADHS. HVF
Template Known Secondary structure  TT
S................
TTTS
.S
Template Predicted Secondary structure 






................








.


Template SS confidence 





























































   318.320.........330.........340..... ....350......... 360..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions