Return to main results Retrieve Phyre Job Id

Job DescriptionQ47138
Confidence4.49%DateThu Jan 5 12:36:15 GMT 2012
Rank45Aligned Residues28
% Identity14%Templated1xgsa1
SCOP infoDNA/RNA-binding 3-helical bundle "Winged helix" DNA-binding domain Methionine aminopeptidase, insert domain
Resolution1.75

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   170.........180.........190.........200....
Predicted Secondary structure 












Query SS confidence 


































Query Sequence  HAIGWVKHKCIPGAKWPEIQAEMRIWKKRREGERK
Query Conservation   

 

          
 
  
   
    

 

Alig confidence 













.......













Template Conservation   

  
   
 


.......
  


     
  
Template Sequence  FLLAKIKREYGTLP. . . . . . . FAYRWLQNDMPEGQ
Template Known Secondary structure  TTTS
.......SGGGTTTS
Template Predicted Secondary structure 




.......




Template SS confidence 


































   221........230.... .....240........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions