Return to main results Retrieve Phyre Job Id

Job DescriptionQ47138
Confidence3.08%DateThu Jan 5 12:36:15 GMT 2012
Rank68Aligned Residues32
% Identity28%Templated1nvpd1
SCOP infoTranscription factor IIA (TFIIA), alpha-helical domain Transcription factor IIA (TFIIA), alpha-helical domain Transcription factor IIA (TFIIA), alpha-helical domain
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   127..130.........140... ......150........
Predicted Secondary structure 



..........



Query SS confidence 
















. . . . . . . . . .














Query Sequence  ITVDMVISAQELLQEDM. . . . . . . . . . ATFDGHIVEALMKMP
Query Conservation    
        

  
 ..........
   
 
  

    
Alig confidence 
















..........














Template Conservation 

 

 






    
 
 

 


  




   
   
Template Sequence  LGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRV
Template Known Secondary structure  TTSS
T
Template Predicted Secondary structure 





Template SS confidence 









































   11........20.........30.........40.........50..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions