Return to main results Retrieve Phyre Job Id

Job DescriptionQ47138
Confidence2.75%DateThu Jan 5 12:36:15 GMT 2012
Rank98Aligned Residues30
% Identity17%Templatec3tmgA_
PDB info PDB header:transport proteinChain: A: PDB Molecule:glycine betaine, l-proline abc transporter, PDBTitle: crystal structure of glycine betaine, l-proline abc transporter,2 glycine/betaine/l-proline-binding protein (prox) from borrelia3 burgdorferi
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   187..190.........200.........210.........220.........230.........240.........250..
Predicted Secondary structure 














































Query SS confidence 

































































Query Sequence  EIQAEMRIWKKRREGERKETGKYTSVVDLARARANQQYTENSTGKISPVIAAIHREYKQTWKTLDD
Query Conservation   
  
   
    

 

         
 
            
   
   
   
 








 
Alig confidence 



















....................................









Template Conservation       
  

  
 
    
....................................
         
Template Sequence  KEYRNAVEFVEKNKEIVKTW. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . VPEKYKTLFD
Template Known Secondary structure 
TTT....................................S
GGGGGGG
Template Predicted Secondary structure 

....................................

Template SS confidence 

































































   261........270.........280 .........290
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions